PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I02380.1.p
Common NameEUGRSUZ_I02380, LOC104419685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family SRS
Protein Properties Length: 363aa    MW: 37613.2 Da    PI: 7.5865
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I02380.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702205.61.3e-631392823154
            DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa....aeaaskrkrelkskkqsalsstkl 91 
                        g++sCqdCGnqakkdC h RCRtCCksrgfdC+thvkstWvpaakrrerqqqlaa+++++ +++    + +askr+r++    +        
  Eucgr.I02380.1.p 139 RGGISCQDCGNQAKKDCPHLRCRTCCKSRGFDCSTHVKSTWVPAAKRRERQQQLAALKEHHHQEQrlqlRGEASKRQRDD----RG------- 220
                       5789****************************************************977665544222222222222222....22....... PP

            DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                        + +s+    + ++P+evss+avfrcv+vssvdd +e++aYqtav+igGhvf+GiLyd+G+++
  Eucgr.I02380.1.p 221 -RPNSSGLELVGNFPAEVSSPAVFRCVKVSSVDDPDEQFAYQTAVNIGGHVFRGILYDHGPDH 282
                       .222222334567************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.8E-65141281IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016236.6E-27143185IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.6E-26233280IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MAGFIPLGGG GGGAARSAAG AGGGGGGGDQ QINHPQATAT AEIPWFYYPR SNVDDVGTSS  60
TYKGLELWHQ NQPQTQQQLH FFSQQQQDLY ASAAGLGVGP SGGGGSGRGS INVFSDESSR  120
SGGGFTTSTS AATTGGGMRG GISCQDCGNQ AKKDCPHLRC RTCCKSRGFD CSTHVKSTWV  180
PAAKRRERQQ QLAALKEHHH QEQRLQLRGE ASKRQRDDRG RPNSSGLELV GNFPAEVSSP  240
AVFRCVKVSS VDDPDEQFAY QTAVNIGGHV FRGILYDHGP DHPSYTNVAA GDSSSGGGGG  300
GGLVQPLDLI AAAATAAASP ITNAESAHVS SATAPFFDSA SLYPPPLSTY MAGTQFFPHP  360
RS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I02380.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029724.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9XGX03e-85SHI_ARATH; Protein SHORT INTERNODES
TrEMBLA0A059ART00.0A0A059ART0_EUCGR; Uncharacterized protein
STRINGPOPTR_0007s13610.16e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.15e-71Lateral root primordium (LRP) protein-related